Détails de la société
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • Type d'Affaires:Fabricant
  • Main Mark: Amériques , Asie , Europe de l'Est , L'Europe  , Europe du Nord , Autres marchés , Europe occidentale , À l'échelle mondiale
  • Exportateur:91% - 100%
  • certs:GS, CE, ISO9001, ISO14000
  • La description:Teriparatide Acétate PTH 1-34,Peptide Fragment Teriparatide Acétate 52232-67-4,De la bonne qualité Polypeptide Hormones Poudre Teriparat 52232-67-4
Taizhou Volsen Chemical Co., Ltd. Teriparatide Acétate PTH 1-34,Peptide Fragment Teriparatide Acétate 52232-67-4,De la bonne qualité Polypeptide Hormones Poudre Teriparat 52232-67-4
Accueil > Liste de Produits > Produits peptidiques > HORMONE PARATHYROIDE (HUMAIN, 1-34) 52232-67-4

HORMONE PARATHYROIDE (HUMAIN, 1-34) 52232-67-4

Partager sur:  
    Prix ​​unitaire: USD 1 / Kilogram
    Type de paiement: T/T
    Incoterm: CIF
    Quantité de commande minimum: 1 Kilogram
    Délai de livraison: 15 jours

Informations de base

Modèle: 52232-67-4

Additional Info

Détails d'emballage: COMME DEMANDÉ

productivité: KGS

marque: VOLSENCHEM

transport: Air

Lieu d'origine: CHINE

Capacité d'approvisionnement: TRUE MANUFACTURER

Certificats : GMP Peptide

Description du produit

< Span style = "font-size: 9pt; font-family: Arial;">

Nous, Chine Teriparatide Acétate 52232-67-4 Fournisseurs et Chine pTH (1-34) ( Humain) | Teriparatide Fabricants, fournissent Chine fragment d'hormone parathyroïde (1-34) produit Et les produits liés à Chine PARATHYROID HORMONE HUMAN 1-34

Thera. Cat egory: Peptide pharmaceutique

Cas No .: 52232-67-4 < / Span>

Synonymes < / Strong>: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34 ; HATHONE PARATHYROÏDE (HUMAIN, 1-34) ; HATHONE PARATHYROIDE (1-34), HUMAIN ; PTH (1-34) (HUMAN) ; PTH (HUMAN, 1-34) ; TERIPARATIDE ; Teriparatide Acétate ; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

; Text-indent: -21pt; "> bonne qualité Polypeptide Hormones Poudre Teriparatide

Formule moléculaire : C172H278N52O47S2 < / Span>
< / P>

Poids moléculaire : < Span style = "font-family: Tahoma; line-height: normal; background-color: #FAFAFA;"> 3890.49792

Pureté: < / Strong> ≥98%

Emballage : Exporter un emballage digne

Fiche de données de sécurité : Disponible sur demande < P> Usage: La teriparatide est identique à une partie de l'hormone parathyrod humaine (PTH) et l'utilisation intermittente active les ostéoblastes plus que les ostéoclates , ce qui conduit à une Augmentation globale des os.

< / Span>

Groupes de Produits : Produits peptidiques

image de Produit
  • HORMONE PARATHYROIDE (HUMAIN, 1-34) 52232-67-4
Envoyer à ce fournisseur
  • *Sujet:
  • *Messages:
    Votre message doit comporter de 20 à 8000 caractères
Copyright © 2019 Taizhou Volsen Chemical Co., Ltd.Tous droits réservés.
Contacter le Fournisseur?fournisseur
Amy Cheng Ms. Amy Cheng
Que puis-je faire pour vous?