Taizhou Volsen Chemical Co., Ltd.
AccueilListe de Produits Produits peptidiquesFragment d'hormone parathyroïdienne (1-34) (CAS 52232-67-4)
Fragment d'hormone parathyroïdienne (1-34) (CAS 52232-67-4)
  • Fragment d'hormone parathyroïdienne (1-34) (CAS 52232-67-4)

Fragment d'hormone parathyroïdienne (1-34) (CAS 52232-67-4)

    Prix ​​unitaire: USD 1 / Kilogram
    Type de paiement: T/T
    Incoterm: CIF
    Quantité de commande minimum: 1 Kilogram
    Délai de livraison: 15 jours

Informations de base

Modèle: 52232-67-4

Additional Info

Détails d'emballage: COMME DEMANDÉ

productivité: KGS

marque: VOLSENCHEM

transport: Air

Lieu d'origine: CHINE

Capacité d'approvisionnement: TRUE MANUFACTURER

Certificats : GMP Peptide

Description du produit


Nous sommes l' un de l'acétate tériparatide

CAS 52232-67-4 fournisseurs sur le marché chinois. La teriparatide est une forme recombinante d'hormone parathyroïdienne. Il s'agit d'un agent efficace anabolisant (c.-à-d. Croissance osseuse) utilisé dans le traitement de certaines formes d'ostéoporose et également occasionnellement utilisé hors étiquette pour accélérer la cicatrisation des fractures. L'acétate de teriparatide 52232-67-4 est connu pour une action rapide, une qualité constante et une pureté élevée. Nous sommes reconnaissants par de nombreux clients que nous avons coopérés.



Thera. Gorie Cat: Peptide pharmaceutique

Cas No:. 52232-67-4

Synonymes: parathyroïdienne humaine HORMONES: FRAGMENTS 1-34; PARATHORMONE (humaines, 1-34); PARATHORMONE (1-34), Human; PTH (1-34) (humain); PTH (humaines, 1-34); TÉRIPARATIDE; Acétate de tériparatide; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

Formule moléculaire: C172H278N52O47S2

Poids moléculaire: 3890,49792

Pureté: ≥98%

Emballage: L' emballage d'exportation digne

Fiche signalétique: Disponible sur demande

Utilisation: dans le traitement de certaines formes d'ostéoporose

Groupes de Produits : Produits peptidiques

Envoyer à ce fournisseur
  • Amy ChengMs. Amy Cheng
  • Votre message doit comporter de 20 à 8000 caractères

Produits connexes