Détails de la société
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • Type d'Affaires:Fabricant
  • Main Mark: Amériques , Asie , Europe de l'Est , L'Europe  , Europe du Nord , Autres marchés , Europe occidentale , À l'échelle mondiale
  • Exportateur:91% - 100%
  • certs:GS, CE, ISO9001, ISO14000
  • La description:Fragment d'hormone parathyroïde 52232-67-4,Fragment d'hormone parathyroïde CAS 52232-67-4,PTH 1-34 Human
Taizhou Volsen Chemical Co., Ltd. Fragment d'hormone parathyroïde 52232-67-4,Fragment d'hormone parathyroïde CAS 52232-67-4,PTH 1-34 Human
Accueil > Liste de Produits > Produits peptidiques > Fragment d'hormone parathyroïdienne (1-34) (CAS 52232-67-4)

Fragment d'hormone parathyroïdienne (1-34) (CAS 52232-67-4)

Partager sur:  
    Prix ​​unitaire: USD 1 / Kilogram
    Type de paiement: T/T
    Incoterm: CIF
    Quantité de commande minimum: 1 Kilogram
    Délai de livraison: 15 jours

Informations de base

Modèle: 52232-67-4

Additional Info

Détails d'emballage: COMME DEMANDÉ

productivité: KGS

marque: VOLSENCHEM

transport: Air

Lieu d'origine: CHINE

Capacité d'approvisionnement: TRUE MANUFACTURER

Certificats : GMP Peptide

Description du produit


Nous sommes l' un de l'acétate tériparatide

CAS 52232-67-4 fournisseurs sur le marché chinois. La teriparatide est une forme recombinante d'hormone parathyroïdienne. Il s'agit d'un agent efficace anabolisant (c.-à-d. Croissance osseuse) utilisé dans le traitement de certaines formes d'ostéoporose et également occasionnellement utilisé hors étiquette pour accélérer la cicatrisation des fractures. L'acétate de teriparatide 52232-67-4 est connu pour une action rapide, une qualité constante et une pureté élevée. Nous sommes reconnaissants par de nombreux clients que nous avons coopérés.



Thera. Gorie Cat: Peptide pharmaceutique

Cas No:. 52232-67-4

Synonymes: parathyroïdienne humaine HORMONES: FRAGMENTS 1-34; PARATHORMONE (humaines, 1-34); PARATHORMONE (1-34), Human; PTH (1-34) (humain); PTH (humaines, 1-34); TÉRIPARATIDE; Acétate de tériparatide; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

Formule moléculaire: C172H278N52O47S2

Poids moléculaire: 3890,49792

Pureté: ≥98%

Emballage: L' emballage d'exportation digne

Fiche signalétique: Disponible sur demande

Utilisation: dans le traitement de certaines formes d'ostéoporose

Groupes de Produits : Produits peptidiques

image de Produit
  • Fragment d'hormone parathyroïdienne (1-34) (CAS 52232-67-4)
Envoyer à ce fournisseur
  • *Sujet:
  • *Messages:
    Votre message doit comporter de 20 à 8000 caractères

Site Web mobile Index. Plan du site


Abonnez-vous à notre newsletter:
Recevez des nouvelles, Offres spéciales, Big Prix, Réductions

MultiLanguage:
Copyright © 2019 Taizhou Volsen Chemical Co., Ltd.Tous droits réservés.
Contacter le Fournisseur?fournisseur
Amy Cheng Ms. Amy Cheng
Que puis-je faire pour vous?
T'Chat contacter le fournisseur