Détails de la société
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • Type d'Affaires:Fabricant
  • Main Mark: Amériques , Asie , Europe de l'Est , L'Europe  , Europe du Nord , Autres marchés , Europe occidentale , À l'échelle mondiale
  • Exportateur:91% - 100%
  • certs:GS, CE, ISO9001, ISO14000
  • La description:Acétate de teriparatide,52232-67-4,CAS 52232-67-4
Taizhou Volsen Chemical Co., Ltd. Acétate de teriparatide,52232-67-4,CAS 52232-67-4
Accueil > Liste de Produits > Produits peptidiques > Acétate de teriparatide 52232-67-4

Acétate de teriparatide 52232-67-4

Partager sur:  
    Prix ​​unitaire: 1~1 USD
    Type de paiement: T/T
    Incoterm: CIF
    Quantité de commande minimum: 1 Kilogram
    Délai de livraison: 15 jours

Informations de base

Modèle: 52232-67-4

Additional Info

Détails d'emballage: COMME DEMANDÉ

productivité: KGS

marque: VOLSENCHEM

transport: Air

Lieu d'origine: CHINE

Capacité d'approvisionnement: TRUE MANUFACTURER

Certificats : GMP Peptide

Description du produit

Nous, la Chine tériparatide acétate 52232-67-4 Les fournisseurs et la Chine PTH (1-34) (humaine) | Teriparatide Les fabricants, fournissent fragment d'hormone parathyroïdienne Chine (1-34) produits et les produits liés avec la Chine PARATHORMONE HUMAINES 1-34

Thera. Gorie Cat: Peptide pharmaceutique

Cas No:. 52232-67-4

Synonymes: parathyroïdienne humaine HORMONES: FRAGMENTS 1-34; PARATHORMONE (humaines, 1-34); PARATHORMONE (1-34), Human; PTH (1-34) (humain); PTH (humaines, 1-34); TÉRIPARATIDE; Acétate de tériparatide; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

Formule moléculaire: C172H278N52O47S2

Poids moléculaire: 3890,49792

Pureté: ≥98%

Emballage: L' emballage d'exportation digne

Fiche signalétique: Disponible sur demande

Utilisation: tériparatide est identique à une partie de l' hormone de parathyrod humaine (PTH) et une utilisation intermittente active ostéoblastes plus osteoclates, ce qui conduit à une augmentation globale de l' os.

Groupes de Produits : Produits peptidiques

image de Produit
  • Acétate de teriparatide 52232-67-4
Envoyer à ce fournisseur
  • *Sujet:
  • *Messages:
    Votre message doit comporter de 20 à 8000 caractères

Site Web mobile Index. Plan du site


Abonnez-vous à notre newsletter:
Recevez des nouvelles, Offres spéciales, Big Prix, Réductions

MultiLanguage:
Copyright © 2019 Taizhou Volsen Chemical Co., Ltd.Tous droits réservés.
Contacter le Fournisseur?fournisseur
Amy Cheng Ms. Amy Cheng
Que puis-je faire pour vous?
T'Chat contacter le fournisseur