Contacter le Fournisseur? fournisseur
Amy Cheng Ms. Amy Cheng
Que puis-je faire pour vous?
T'Chat contacter le fournisseur
Taizhou Volsen Chemical Co., Ltd.
AccueilListe de Produits Produits peptidiquesAcétate de teriparatide 52232-67-4
Acétate de teriparatide 52232-67-4
  • Acétate de teriparatide 52232-67-4

Acétate de teriparatide 52232-67-4

    Prix ​​unitaire: 1~1 USD
    Type de paiement: T/T
    Incoterm: CIF
    Quantité de commande minimum: 1 Kilogram
    Délai de livraison: 15 jours

Informations de base

Modèle: 52232-67-4

Additional Info

Détails d'emballage: COMME DEMANDÉ

productivité: KGS

marque: VOLSENCHEM

transport: Air

Lieu d'origine: CHINE

Capacité d'approvisionnement: TRUE MANUFACTURER

Certificats : GMP Peptide

Description du produit

Nous, la Chine tériparatide acétate 52232-67-4 Les fournisseurs et la Chine PTH (1-34) (humaine) | Teriparatide Les fabricants, fournissent fragment d'hormone parathyroïdienne Chine (1-34) produits et les produits liés avec la Chine PARATHORMONE HUMAINES 1-34

Thera. Gorie Cat: Peptide pharmaceutique

Cas No:. 52232-67-4

Synonymes: parathyroïdienne humaine HORMONES: FRAGMENTS 1-34; PARATHORMONE (humaines, 1-34); PARATHORMONE (1-34), Human; PTH (1-34) (humain); PTH (humaines, 1-34); TÉRIPARATIDE; Acétate de tériparatide; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

Formule moléculaire: C172H278N52O47S2

Poids moléculaire: 3890,49792

Pureté: ≥98%

Emballage: L' emballage d'exportation digne

Fiche signalétique: Disponible sur demande

Utilisation: tériparatide est identique à une partie de l' hormone de parathyrod humaine (PTH) et une utilisation intermittente active ostéoblastes plus osteoclates, ce qui conduit à une augmentation globale de l' os.

Groupes de Produits : Produits peptidiques

Envoyer à ce fournisseur
  • Amy ChengMs. Amy Cheng
  • Votre message doit comporter de 20 à 8000 caractères

Produits connexes